JMJD6 (NM_015167) Human Recombinant Protein
CAT＃: TP308993
Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg
View other "JMJD6" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208993 protein sequence
Red=Cloning site Green=Tags(s) MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Co-immunoprecipitation (PMID: 28790175) |
| Reference Data | |
| RefSeq | NP_055982 |
| Locus ID | 23210 |
| UniProt ID | Q6NYC1 |
| Refseq Size | 1834 |
| Cytogenetics | 17q25.1 |
| Refseq ORF | 1209 |
| Synonyms | PSR; PTDSR; PTDSR1 |
| Summary | This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Antibody-mediated blockade of JMJD6 interaction with collagen I exerts antifibrotic and antimetastatic activities
,Miotti, S;Gulino, A;Ferri, R;Parenza, M;Chronowska, A;,
The FASEB Journal
,PubMed ID 28790175
[JMJD6]
|
|
Redistribution of demethylated RNA helicase A during foot-and-mouth disease virus infection: Role of Jumonji C-domain containing protein 6 in RHA demethylation
,Lawrence, P;Conderino, JS;Rieder, E;,
Virology, 3 2014.
[JMJD6]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414758 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421156 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414758 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 |
CNY 3080.00 |
|
| LY421156 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 |
CNY 3080.00 |
|
| PH308993 | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982) |
CNY 19520.00 |
|
| PH318163 | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) |
CNY 19520.00 |
|
| TP318163 | Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg |
CNY 2900.00 |
