JMJD6 (NM_015167) Human Mass Spec Standard
CAT＃: PH308993
JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982)
View other "JMJD6" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_055982) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208993 |
| Predicted MW | 46.5 kDa |
| Protein Sequence |
>RC208993 protein sequence
Red=Cloning site Green=Tags(s) MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055982 |
| RefSeq Size | 1834 |
| RefSeq ORF | 1209 |
| Synonyms | PSR; PTDSR; PTDSR1 |
| Locus ID | 23210 |
| Cytogenetics | 17q25.1 |
| Summary | This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414758 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421156 | JMJD6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414758 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2 |
CNY 3080.00 |
|
| LY421156 | Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 1 |
CNY 3080.00 |
|
| PH318163 | JMJD6 MS Standard C13 and N15-labeled recombinant protein (NP_001074930) |
CNY 19520.00 |
|
| TP308993 | Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP318163 | Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 1, 20 µg |
CNY 2900.00 |
