Cathelicidin (CAMP) (NM_004345) Human Recombinant Protein
CAT#: TP308872
Recombinant protein of human cathelicidin antimicrobial peptide (CAMP), 20 µg
View other "Cathelicidin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208872 protein sequence
Red=Cloning site Green=Tags(s) MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR KSKEKIGKEFKRIVQRIKDFLRNLVPRTES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004336 |
| Locus ID | 820 |
| UniProt ID | P49913 |
| Refseq Size | 758 |
| Cytogenetics | 3p21.31 |
| Refseq ORF | 510 |
| Synonyms | CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37 |
| Summary | This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401385 | CAMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401385 | Transient overexpression lysate of cathelicidin antimicrobial peptide (CAMP) |
CNY 3080.00 |
|
| PH308872 | CAMP MS Standard C13 and N15-labeled recombinant protein (NP_004336) |
CNY 19520.00 |
其它Cathelicidin产品
