Cathelicidin (CAMP) (NM_004345) Human Mass Spec Standard
CAT#: PH308872
CAMP MS Standard C13 and N15-labeled recombinant protein (NP_004336)
View other "Cathelicidin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CAMP MS Standard C13 and N15-labeled recombinant protein (NP_004336) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208872 |
| Predicted MW | 19.3 kDa |
| Protein Sequence |
>RC208872 protein sequence
Red=Cloning site Green=Tags(s) MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGD PDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFR KSKEKIGKEFKRIVQRIKDFLRNLVPRTES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004336 |
| RefSeq Size | 758 |
| RefSeq ORF | 510 |
| Synonyms | CAP-18; CAP18; CRAMP; FALL-39; FALL39; HSD26; LL37 |
| Locus ID | 820 |
| Cytogenetics | 3p21.31 |
| Summary | This gene encodes a member of an antimicrobial peptide family, characterized by a highly conserved N-terminal signal peptide containing a cathelin domain and a structurally variable cationic antimicrobial peptide, which is produced by extracellular proteolysis from the C-terminus. In addition to its antibacterial, antifungal, and antiviral activities, the encoded protein functions in cell chemotaxis, immune mediator induction, and inflammatory response regulation. [provided by RefSeq, Sep 2014] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401385 | CAMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401385 | Transient overexpression lysate of cathelicidin antimicrobial peptide (CAMP) |
CNY 3080.00 |
|
| TP308872 | Recombinant protein of human cathelicidin antimicrobial peptide (CAMP), 20 µg |
CNY 2900.00 |
其它Cathelicidin产品
