PRR4 (NM_007244) Human Recombinant Protein
CAT#: TP308870
Purified recombinant protein of Homo sapiens proline rich 4 (lacrimal) (PRR4), transcript variant 2, 20 µg
View other "PRR4" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208870 representing NM_007244
Red=Cloning site Green=Tags(s) MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQ QRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEASSFFRRDRPARHPQEQPLW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009175 |
Locus ID | 11272 |
UniProt ID | Q16378 |
Refseq Size | 507 |
Cytogenetics | 12p13.2 |
Refseq ORF | 402 |
Synonyms | LPRP; PROL4 |
Summary | This gene encodes a member of the proline-rich protein family that lacks a conserved repetitive domain. This protein may play a role in protective functions in the eye. Alternative splicing result in multiple transcript variants. Read-through transcription also exists between this gene and the upstream PRH1 (proline-rich protein HaeIII subfamily 1) gene. [provided by RefSeq, Feb 2011] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416104 | PRR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420635 | PRR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416104 | Transient overexpression lysate of proline rich 4 (lacrimal) (PRR4), transcript variant 2 |
CNY 3080.00 |
|
LY420635 | Transient overexpression lysate of proline rich 4 (lacrimal) (PRR4), transcript variant 1 |
CNY 3080.00 |
|
PH308870 | PRR4 MS Standard C13 and N15-labeled recombinant protein (NP_009175) |
CNY 14250.00 |