PRR4 (NM_007244) Human Mass Spec Standard
CAT#: PH308870
PRR4 MS Standard C13 and N15-labeled recombinant protein (NP_009175)
View other "PRR4" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
| Product Data | |
| Description | PRR4 MS Standard C13 and N15-labeled recombinant protein (NP_009175) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208870 |
| Predicted MW | 14.9 kDa |
| Protein Sequence |
>RC208870 representing NM_007244
Red=Cloning site Green=Tags(s) MLLVLLSVVLLALSSAQSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQ QRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEASSFFRRDRPARHPQEQPLW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009175 |
| RefSeq Size | 507 |
| RefSeq ORF | 402 |
| Synonyms | LPRP; PROL4 |
| Locus ID | 11272 |
| Cytogenetics | 12p13.2 |
| Summary | This gene encodes a member of the proline-rich protein family that lacks a conserved repetitive domain. This protein may play a role in protective functions in the eye. Alternative splicing result in multiple transcript variants. Read-through transcription also exists between this gene and the upstream PRH1 (proline-rich protein HaeIII subfamily 1) gene. [provided by RefSeq, Feb 2011] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416104 | PRR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420635 | PRR4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416104 | Transient overexpression lysate of proline rich 4 (lacrimal) (PRR4), transcript variant 2 |
CNY 3080.00 |
|
| LY420635 | Transient overexpression lysate of proline rich 4 (lacrimal) (PRR4), transcript variant 1 |
CNY 3080.00 |
|
| TP308870 | Purified recombinant protein of Homo sapiens proline rich 4 (lacrimal) (PRR4), transcript variant 2, 20 µg |
CNY 2900.00 |
