CMC1 (NM_182523) Human Recombinant Protein
CAT#: TP308801
Recombinant protein of human COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein, 20 µg
View other "CMC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208801 protein sequence
Red=Cloning site Green=Tags(s) MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_872329 |
Locus ID | 152100 |
UniProt ID | Q7Z7K0 |
Refseq Size | 640 |
Cytogenetics | 3p24.1 |
Refseq ORF | 318 |
Synonyms | C3orf68 |
Summary | Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405501 | CMC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405501 | Transient overexpression lysate of COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
PH308801 | CMC1 MS Standard C13 and N15-labeled recombinant protein (NP_872329) |
CNY 19520.00 |