CMC1 (NM_182523) Human Mass Spec Standard
CAT#: PH308801
CMC1 MS Standard C13 and N15-labeled recombinant protein (NP_872329)
View other "CMC1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CMC1 MS Standard C13 and N15-labeled recombinant protein (NP_872329) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208801 |
Predicted MW | 12.5 kDa |
Protein Sequence |
>RC208801 protein sequence
Red=Cloning site Green=Tags(s) MALDPADQHLRHVEKDVLIPKIMREKAKERCSEQVQDFTKCCKNSGVLMVVKCRKENSALKECLTAYYND PAFYEECKMEYLKEREEFRKTGIPTKKRLQKLPTSM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_872329 |
RefSeq Size | 640 |
RefSeq ORF | 318 |
Synonyms | C3orf68 |
Locus ID | 152100 |
Cytogenetics | 3p24.1 |
Summary | Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405501 | CMC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405501 | Transient overexpression lysate of COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP308801 | Recombinant protein of human COX assembly mitochondrial protein homolog (S. cerevisiae) (CMC1), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |