Galectin 3 (LGALS3) (NM_002306) Human Recombinant Protein
CAT#: TP308785
Recombinant protein of human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, 20 µg
View other "Galectin 3" proteins (4)
| Need it in bulk or customized? Get a free quote | Avi-tag Biotinylated Protein Get a free quote | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 3990.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | >RC208785 protein sequence Red=Cloning site Green=Tags(s) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Predicted MW | 26 kDa | 
| Concentration | >0.1 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_002297 | 
| Locus ID | 3958 | 
| UniProt ID | P17931 | 
| Refseq Size | 1017 | 
| Cytogenetics | 14q22.3 | 
| Refseq ORF | 750 | 
| Synonyms | CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2 | 
| Summary | This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014] | 
| Protein Families | Secreted Protein | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| Targeting galectin-3 with a high-affinity antibody for inhibition of high-grade serous ovarian cancer and other MUC16/CA-125-expressing malignancies
                                                ,Stasenko, M;Smith, E;Yeku, O;Park, KJ;Laster, I;Lee, K;Walderich, S;Spriggs, E;Rueda, B;Weigelt, B;Zamarin, D;Rao, TD;Spriggs, DR;,
                                                Scientific reports
                                                ,PubMed ID 33580170
                                                [LGALS3] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400834 | LGALS3 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY400834 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 | CNY 3080.00 | |
| PH308785 | LGALS3 MS Standard C13 and N15-labeled recombinant protein (NP_002297) | CNY 19520.00 | |
| TP720583 | Purified recombinant protein of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 | CNY 1800.00 | 
其它Galectin 3产品


 
                        

 
        