Galectin 3 (LGALS3) (NM_002306) Human Mass Spec Standard
CAT#: PH308785
LGALS3 MS Standard C13 and N15-labeled recombinant protein (NP_002297)
View other "Galectin 3" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 3990.00
Specifications
| Product Data | |
| Description | LGALS3 MS Standard C13 and N15-labeled recombinant protein (NP_002297) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208785 |
| Predicted MW | 26.2 kDa |
| Protein Sequence |
>RC208785 protein sequence
Red=Cloning site Green=Tags(s) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002297 |
| RefSeq Size | 1017 |
| RefSeq ORF | 750 |
| Synonyms | CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2 |
| Locus ID | 3958 |
| Cytogenetics | 14q22.3 |
| Summary | This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400834 | LGALS3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400834 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 |
CNY 3080.00 |
|
| TP308785 | Recombinant protein of human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP720583 | Purified recombinant protein of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 |
CNY 1800.00 |
其它Galectin 3产品
