PITPN (PITPNA) (NM_006224) Human Recombinant Protein
CAT#: TP308326
Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA), 20 µg
View other "PITPN" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208326 protein sequence
Red=Cloning site Green=Tags(s) MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPT FVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVY IDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVE NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006215 |
| Locus ID | 5306 |
| UniProt ID | Q00169 |
| Refseq Size | 3660 |
| Cytogenetics | 17p13.3 |
| Refseq ORF | 810 |
| Synonyms | HEL-S-36; PI-TPalpha; PITPN; VIB1A |
| Summary | This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase.[provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416790 | PITPNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416790 | Transient overexpression lysate of phosphatidylinositol transfer protein, alpha (PITPNA) |
CNY 3080.00 |
|
| PH308326 | PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215) |
CNY 19520.00 |
|
| TP720513 | Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA) |
CNY 1800.00 |


