PITPN (PITPNA) (NM_006224) Human Mass Spec Standard
CAT#: PH308326
PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215)
View other "PITPN" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PITPNA MS Standard C13 and N15-labeled recombinant protein (NP_006215) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208326 |
| Predicted MW | 31.8 kDa |
| Protein Sequence |
>RC208326 protein sequence
Red=Cloning site Green=Tags(s) MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPT FVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTQENVHKLEPEAWKHVEAVY IDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVE NFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006215 |
| RefSeq Size | 3660 |
| RefSeq ORF | 810 |
| Synonyms | HEL-S-36; PI-TPalpha; PITPN; VIB1A |
| Locus ID | 5306 |
| Cytogenetics | 17p13.3 |
| Summary | This gene encodes a member of a family of lipid-binding proteins that transfer molecules of phosphatidylinositol or phosphatidylcholine between membrane surfaces. The protein is implicated in phospholipase C signaling and in the production of phosphatidylinositol 3,4,5-trisphosphate (PIP3) by phosphoinositide-3-kinase.[provided by RefSeq, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416790 | PITPNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416790 | Transient overexpression lysate of phosphatidylinositol transfer protein, alpha (PITPNA) |
CNY 3080.00 |
|
| TP308326 | Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA), 20 µg |
CNY 2900.00 |
|
| TP720513 | Recombinant protein of human phosphatidylinositol transfer protein, alpha (PITPNA) |
CNY 1800.00 |

