PKC delta (PRKCD) (NM_212539) Human Recombinant Protein
CAT#: TP308127
Recombinant protein of human protein kinase C, delta (PRKCD), transcript variant 2, 20 µg
View other "PKC delta" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208127 protein sequence
Red=Cloning site Green=Tags(s) MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQ IVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFP TMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTG TAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC GINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFI FHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIA DFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESI RVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDY SNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 77.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997704 |
Locus ID | 5580 |
UniProt ID | Q05655 |
Refseq Size | 2738 |
Cytogenetics | 3p21.1 |
Refseq ORF | 2028 |
Synonyms | ALPS3; CVID9; MAY1; nPKC-delta; PKCD |
Summary | The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome. [provided by RefSeq, Aug 2017] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Chemokine signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, GnRH signaling pathway, Neurotrophin signaling pathway, Tight junction, Type II diabetes mellitus, Vascular smooth muscle contraction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403724 | PRKCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416774 | PRKCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY403724 | Transient overexpression lysate of protein kinase C, delta (PRKCD), transcript variant 2 |
CNY 3080.00 |
|
LY416774 | Transient overexpression lysate of protein kinase C, delta (PRKCD), transcript variant 1 |
CNY 4840.00 |
|
PH308127 | PRKCD MS Standard C13 and N15-labeled recombinant protein (NP_997704) |
CNY 19520.00 |
其它PKC delta产品