PKC delta (PRKCD) (NM_212539) Human Mass Spec Standard
CAT#: PH308127
PRKCD MS Standard C13 and N15-labeled recombinant protein (NP_997704)
View other "PKC delta" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
| Cited in 1 publication. |
CNY 4840.00
Specifications
| Product Data | |
| Description | PRKCD MS Standard C13 and N15-labeled recombinant protein (NP_997704) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208127 |
| Predicted MW | 77.5 kDa |
| Protein Sequence |
>RC208127 protein sequence
Red=Cloning site Green=Tags(s) MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQ IVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFP TMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTG TAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC GINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFI FHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIA DFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESI RVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDY SNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_997704 |
| RefSeq Size | 2738 |
| RefSeq ORF | 2028 |
| Synonyms | ALPS3; CVID9; MAY1; nPKC-delta; PKCD |
| Locus ID | 5580 |
| Cytogenetics | 3p21.1 |
| Summary | The protein encoded by this gene is a member of the protein kinase C family of serine- and threonine-specific protein kinases. The encoded protein is activated by diacylglycerol and is both a tumor suppressor and a positive regulator of cell cycle progression. Also, this protein can positively or negatively regulate apoptosis. Defects in this gene are a cause of autoimmune lymphoproliferative syndrome. [provided by RefSeq, Aug 2017] |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Chemokine signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, GnRH signaling pathway, Neurotrophin signaling pathway, Tight junction, Type II diabetes mellitus, Vascular smooth muscle contraction |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Multiple suppression pathways of canonical Wnt signalling control thymic epithelial senescence
,null,
Mechanisms of Ageing and Development
,PubMed ID 21549744
[PRKCD]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403724 | PRKCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416774 | PRKCD HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY403724 | Transient overexpression lysate of protein kinase C, delta (PRKCD), transcript variant 2 |
CNY 3080.00 |
|
| LY416774 | Transient overexpression lysate of protein kinase C, delta (PRKCD), transcript variant 1 |
CNY 4840.00 |
|
| TP308127 | Recombinant protein of human protein kinase C, delta (PRKCD), transcript variant 2, 20 µg |
CNY 2900.00 |
其它PKC delta产品


