RALA (NM_005402) Human Recombinant Protein
CAT#: TP308076
Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 20 µg
View other "RALA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208076 protein sequence
Red=Cloning site Green=Tags(s) MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005393 |
| Locus ID | 5898 |
| UniProt ID | P11233 |
| Refseq Size | 2828 |
| Cytogenetics | 7p14.1 |
| Refseq ORF | 618 |
| Synonyms | HINCONS; RAL |
| Summary | The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pancreatic cancer, Pathways in cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417324 | RALA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417324 | Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) |
CNY 3080.00 |
|
| PH308076 | RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393) |
CNY 19520.00 |

