RALA (NM_005402) Human Mass Spec Standard
CAT#: PH308076
RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393)
View other "RALA" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RALA MS Standard C13 and N15-labeled recombinant protein (NP_005393) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208076 |
| Predicted MW | 23.6 kDa |
| Protein Sequence |
>RC208076 protein sequence
Red=Cloning site Green=Tags(s) MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTA GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVE EAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_005393 |
| RefSeq Size | 2828 |
| RefSeq ORF | 618 |
| Synonyms | HINCONS; RAL |
| Locus ID | 5898 |
| Cytogenetics | 7p14.1 |
| Summary | The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-like GTP-binding protein that shares about 50% similarity with other ras proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Pancreatic cancer, Pathways in cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417324 | RALA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417324 | Transient overexpression lysate of v-ral simian leukemia viral oncogene homolog A (ras related) (RALA) |
CNY 3080.00 |
|
| TP308076 | Recombinant protein of human v-ral simian leukemia viral oncogene homolog A (ras related) (RALA), 20 µg |
CNY 2900.00 |

