ACSL3 (NM_004457) Human Recombinant Protein
CAT#: TP308032
Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 20 µg
View other "ACSL3" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208032 protein sequence
Red=Cloning site Green=Tags(s) MNNHVSSKPSTMKLKHTINPILLYFIHFLISLYTILTYIPFYFFSESRQEKSNRIKAKPVNSKPDSAYRS VNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWLSYEDV FVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVHALNETEVTNI ITSKELLQTKLKDIVSLVPRLRHIITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSD IAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIG YSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYKMEQI SKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQGYGLTESAGAGTISEVW DYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWL CTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQK ELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKL KRKELKTHYQADIERMYGRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 80.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_004448 |
| Locus ID | 2181 |
| UniProt ID | O95573 |
| Refseq Size | 4369 |
| Cytogenetics | 2q36.1 |
| Refseq ORF | 2160 |
| Synonyms | ACS3; FACL3; LACS 3; LACS3; PRO2194 |
| Summary | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403709 | ACSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417974 | ACSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403709 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2 |
CNY 3080.00 |
|
| LY417974 | Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1 |
CNY 3080.00 |
|
| PH308032 | ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_004448) |
CNY 19520.00 |
|
| PH317537 | ACSL3 MS Standard C13 and N15-labeled recombinant protein (NP_976251) |
CNY 19520.00 |
|
| TP317537 | Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2, 20 µg |
CNY 2900.00 |

