ACSL3 Rabbit Polyclonal Antibody

CAT#: TA339415

Rabbit Polyclonal Anti-ACSL3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of acyl-CoA synthetase long-chain family member 3 (ACSL3), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution IHC, WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 80 kDa
Gene Name acyl-CoA synthetase long-chain family member 3
Background The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Synonyms ACS3; FACL3; PRO2194
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%
Reference Data
Protein Families Transmembrane
Protein Pathways Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...