ACSL3 Rabbit Polyclonal Antibody
CAT#: TA339415
Rabbit Polyclonal Anti-ACSL3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
| Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | IHC, WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 80 kDa |
| Gene Name | acyl-CoA synthetase long-chain family member 3 |
| Database Link | |
| Background | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Synonyms | ACS3; FACL3; PRO2194 |
| Note | Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86% |
| Reference Data | |
| Protein Families | Transmembrane |
| Protein Pathways | Adipocytokine signaling pathway, Fatty acid metabolism, Metabolic pathways, PPAR signaling pathway |
Citations (1)
| The use of this Antibodies has been cited in the following citations: |
|---|
|
Effect of ACSL3 Expression Levels on Preadipocyte Differentiation in Chinese Red Steppe Cattle
,Lv, Y;Cao, Y;Gao, Y;Yun, J;Yu, Y;Zhang, L;Hu, Z;Liu, L;Xue, J;Zhang, G;,
DNA Cell Biol.
,PubMed ID 31355674
[ACSL3]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |

