LSAMP (NM_002338) Human Recombinant Protein
CAT#: TP307618
Recombinant protein of human limbic system-associated membrane protein (LSAMP), 20 µg
View other "LSAMP" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207618 protein sequence
Red=Cloning site Green=Tags(s) MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGI IFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD VTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQ VKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNV TEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002329 |
| Locus ID | 4045 |
| UniProt ID | Q13449 |
| Refseq Size | 9478 |
| Cytogenetics | 3q13.31 |
| Refseq ORF | 1014 |
| Synonyms | IGLON3; LAMP |
| Summary | This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adhesion molecule during axon guidance and neuronal growth in the developing limbic system. The encoded protein may also function as a tumor suppressor and may play a role in neuropsychiatric disorders. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400840 | LSAMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400840 | Transient overexpression lysate of limbic system-associated membrane protein (LSAMP) |
CNY 3080.00 |
|
| PH307618 | LSAMP MS Standard C13 and N15-labeled recombinant protein (NP_002329) |
CNY 19520.00 |
|
| TP721111 | Purified recombinant protein of Human limbic system-associated membrane protein (LSAMP) |
CNY 1800.00 |
