LSAMP (NM_002338) Human Mass Spec Standard
CAT#: PH307618
LSAMP MS Standard C13 and N15-labeled recombinant protein (NP_002329)
View other "LSAMP" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | LSAMP MS Standard C13 and N15-labeled recombinant protein (NP_002329) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207618 |
Predicted MW | 37.4 kDa |
Protein Sequence |
>RC207618 protein sequence
Red=Cloning site Green=Tags(s) MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGI IFAGHDKWSLDPRVELEKRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD VTVNEGSNVTLVCMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQ VKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNV TEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002329 |
RefSeq Size | 9478 |
RefSeq ORF | 1014 |
Synonyms | IGLON3; LAMP |
Locus ID | 4045 |
Cytogenetics | 3q13.31 |
Summary | This gene encodes a member of the immunoglobulin LAMP, OBCAM and neurotrimin (IgLON) family of proteins. The encoded preproprotein is proteolytically processed to generate a neuronal surface glycoprotein. This protein may act as a selective homophilic adhesion molecule during axon guidance and neuronal growth in the developing limbic system. The encoded protein may also function as a tumor suppressor and may play a role in neuropsychiatric disorders. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400840 | LSAMP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400840 | Transient overexpression lysate of limbic system-associated membrane protein (LSAMP) |
CNY 3080.00 |
|
TP307618 | Recombinant protein of human limbic system-associated membrane protein (LSAMP), 20 µg |
CNY 2900.00 |
|
TP721111 | Purified recombinant protein of Human limbic system-associated membrane protein (LSAMP) |
CNY 1800.00 |