CNOT4 (NM_001008225) Human Recombinant Protein
CAT＃: TP307541
Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2, 20 µg
View other "CNOT4" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207541 protein sequence
Red=Cloning site Green=Tags(s) MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSL SIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPP FPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPG QAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQ GQQPTSLHTTVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 62.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001008226 |
| Locus ID | 4850 |
| UniProt ID | O95628 |
| Refseq Size | 3774 |
| Cytogenetics | 7q33 |
| Refseq ORF | 1716 |
| Synonyms | CLONE243; NOT4; NOT4H |
| Summary | The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415669 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423402 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434319 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415669 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1 |
CNY 4840.00 |
|
| LY423402 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2 |
CNY 3080.00 |
|
| LY434319 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 4 |
CNY 3080.00 |
|
| PH307541 | CNOT4 MS Standard C13 and N15-labeled recombinant protein (NP_001008226) |
CNY 19520.00 |
|
| TP762054 | Purified recombinant protein of Human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1,Leu190-Ala455, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |
