CNOT4 (NM_001008225) Human Mass Spec Standard
CAT＃: PH307541
CNOT4 MS Standard C13 and N15-labeled recombinant protein (NP_001008226)
View other "CNOT4" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | CNOT4 MS Standard C13 and N15-labeled recombinant protein (NP_001008226) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207541 |
| Predicted MW | 63.1 kDa |
| Protein Sequence |
>RC207541 protein sequence
Red=Cloning site Green=Tags(s) MSRSPDAKEDPVECPLCMEPLEIDDINFFPCTCGYQICRFCWHRIRTDENGLCPACRKPYPEDPAVYKPL SQEELQRIKNEKKQKQNERKQKISENRKHLASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHK VVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYFLKNMQCPKPDC MYLHELGDEAASFTKEEMQAGKHQEYEQKLLQELYKLNPNFLQLSTGSVDKNKNKVTPLQSPIDKPSDSL SIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPP FPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKEL SVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPG QAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQ GQQPTSLHTTVA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008226 |
| RefSeq Size | 3774 |
| RefSeq ORF | 1716 |
| Synonyms | CLONE243; NOT4; NOT4H |
| Locus ID | 4850 |
| Cytogenetics | 7q33 |
| Summary | The protein encoded by this gene is a subunit of the CCR4-NOT complex, a global transcriptional regulator. The encoded protein interacts with CNOT1 and has E3 ubiquitin ligase activity. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2010] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415669 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC423402 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434319 | CNOT4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415669 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1 |
CNY 4840.00 |
|
| LY423402 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2 |
CNY 3080.00 |
|
| LY434319 | Transient overexpression lysate of CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 4 |
CNY 3080.00 |
|
| TP307541 | Recombinant protein of human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP762054 | Purified recombinant protein of Human CCR4-NOT transcription complex, subunit 4 (CNOT4), transcript variant 1,Leu190-Ala455, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2050.00 |
