ZCCHC9 (NM_032280) Human Recombinant Protein
CAT＃: TP307448
Recombinant protein of human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 1, 20 µg
View other "ZCCHC9" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207448 protein sequence
Red=Cloning site Green=Tags(s) MTRWARVSTTYNKRALPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNE DVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGI ADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADG GGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_115656 |
| Locus ID | 84240 |
| UniProt ID | Q8N567 |
| Refseq Size | 1802 |
| Cytogenetics | 5q14.1 |
| Refseq ORF | 813 |
| Synonyms | PPP1R41 |
| Summary | May down-regulate transcription mediated by NF-kappa-B and the serum response element.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410224 | ZCCHC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427368 | ZCCHC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427369 | ZCCHC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410224 | Transient overexpression lysate of zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 1 |
CNY 3080.00 |
|
| LY427368 | Transient overexpression lysate of zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 2 |
CNY 3080.00 |
|
| LY427369 | Transient overexpression lysate of zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 3 |
CNY 3080.00 |
|
| PH307448 | ZCCHC9 MS Standard C13 and N15-labeled recombinant protein (NP_115656) |
CNY 19520.00 |
|
| TP761247 | Purified recombinant protein of Human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
|
| TP761251 | Purified recombinant protein of Human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
