ZCCHC9 (NM_032280) Human Mass Spec Standard
CAT＃: PH307448
ZCCHC9 MS Standard C13 and N15-labeled recombinant protein (NP_115656)
View other "ZCCHC9" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | ZCCHC9 MS Standard C13 and N15-labeled recombinant protein (NP_115656) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207448 |
| Predicted MW | 30.5 kDa |
| Protein Sequence |
>RC207448 protein sequence
Red=Cloning site Green=Tags(s) MTRWARVSTTYNKRALPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNE DVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGI ADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADG GGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115656 |
| RefSeq Size | 1802 |
| RefSeq ORF | 813 |
| Synonyms | PPP1R41 |
| Locus ID | 84240 |
| Cytogenetics | 5q14.1 |
| Summary | May down-regulate transcription mediated by NF-kappa-B and the serum response element.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410224 | ZCCHC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427368 | ZCCHC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427369 | ZCCHC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410224 | Transient overexpression lysate of zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 1 |
CNY 3080.00 |
|
| LY427368 | Transient overexpression lysate of zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 2 |
CNY 3080.00 |
|
| LY427369 | Transient overexpression lysate of zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 3 |
CNY 3080.00 |
|
| TP307448 | Recombinant protein of human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP761247 | Purified recombinant protein of Human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
|
| TP761251 | Purified recombinant protein of Human zinc finger, CCHC domain containing 9 (ZCCHC9), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
