RAP2A (NM_021033) Human Recombinant Protein
CAT#: TP307180
Recombinant protein of human RAP2A, member of RAS oncogene family (RAP2A), 20 µg
View other "RAP2A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC207180 protein sequence
Red=Cloning site Green=Tags(s) MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066361 |
Locus ID | 5911 |
UniProt ID | P10114 |
Refseq Size | 4358 |
Cytogenetics | 13q32.1 |
Refseq ORF | 549 |
Synonyms | K-REV; KREV; RAP2; RbBP-30 |
Summary | Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402824 | RAP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402824 | Transient overexpression lysate of RAP2A, member of RAS oncogene family (RAP2A) |
CNY 3080.00 |
|
PH307180 | RAP2A MS Standard C13 and N15-labeled recombinant protein (NP_066361) |
CNY 19520.00 |