RAP2A (NM_021033) Human Mass Spec Standard
CAT#: PH307180
RAP2A MS Standard C13 and N15-labeled recombinant protein (NP_066361)
View other "RAP2A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RAP2A MS Standard C13 and N15-labeled recombinant protein (NP_066361) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207180 |
Predicted MW | 20.6 kDa |
Protein Sequence |
>RC207180 protein sequence
Red=Cloning site Green=Tags(s) MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGC PFMETSAKSKTMVDELFAEIVRQMNYAAQPDKDDPCCSACNIQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_066361 |
RefSeq Size | 4358 |
RefSeq ORF | 549 |
Synonyms | K-REV; KREV; RAP2; RbBP-30 |
Locus ID | 5911 |
Cytogenetics | 13q32.1 |
Summary | Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. In its active form interacts with and regulates several effectors including MAP4K4, MINK1 and TNIK. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it is part of several signaling cascades and may regulate cytoskeletal rearrangements, cell migration, cell adhesion and cell spreading.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402824 | RAP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402824 | Transient overexpression lysate of RAP2A, member of RAS oncogene family (RAP2A) |
CNY 3080.00 |
|
TP307180 | Recombinant protein of human RAP2A, member of RAS oncogene family (RAP2A), 20 µg |
CNY 2900.00 |