CD33 (NM_001772) Human Recombinant Protein
CAT＃: TP307023
Recombinant protein of human CD33 molecule (CD33), transcript variant 1, 20 µg
View other "CD33" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC207023 protein sequence
Red=Cloning site Green=Tags(s) MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP SKDTSTEYSEVRTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Association in cell culture (PMID: 27757305) |
| Reference Data | |
| RefSeq | NP_001763 |
| Locus ID | 945 |
| UniProt ID | P20138 |
| Refseq Size | 1466 |
| Cytogenetics | 19q13.41 |
| Refseq ORF | 1092 |
| Synonyms | p67; SIGLEC-3; SIGLEC3 |
| Summary | Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Mono- and dual-targeting triplebodies activate natural killer cells and have anti-tumor activity in vitro and in vivo against chronic lymphocytic leukemia
,Vyas, M;Schneider, AC;Shatnyeva, O;Reiners, KS;Tawadros, S;Kloess, S;Köhl, U;Hallek, M;Hansen, HP;Pogge von Strandmann, E;,
Oncoimmunology
,PubMed ID 27757305
[CD33]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400667 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421195 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425947 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432863 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400667 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 |
CNY 3080.00 |
|
| LY421195 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
CNY 3080.00 |
|
| LY425947 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
CNY 3080.00 |
|
| LY432863 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 |
CNY 3080.00 |
|
| PH307023 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763) |
CNY 19520.00 |
|
| PH317716 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) |
CNY 14250.00 |
|
| TP317716 | Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720665 | Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 |
CNY 3140.00 |
|
| TP723960 | Human CD33 Protein, hFc-His Tag |
CNY 5249.00 |
CD33 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
