CD33 (NM_001082618) Human Mass Spec Standard
CAT＃: PH317716
CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087)
View other "CD33" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217716 |
| Predicted MW | 25.29 kDa |
| Protein Sequence |
>RC217716 representing NM_001082618
Red=Cloning site Green=Tags(s) MPLLLLLPLLWADLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGV TALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEE LHYASLNFHGMNPSKDTSTEYSEVRTQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001076087 |
| RefSeq Size | 1085 |
| RefSeq ORF | 711 |
| Synonyms | p67; SIGLEC-3; SIGLEC3 |
| Locus ID | 945 |
| Cytogenetics | 19q13.41 |
| Summary | Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400667 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421195 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425947 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432863 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400667 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 |
CNY 3080.00 |
|
| LY421195 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
CNY 3080.00 |
|
| LY425947 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 |
CNY 3080.00 |
|
| LY432863 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 |
CNY 3080.00 |
|
| PH307023 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763) |
CNY 19520.00 |
|
| TP307023 | Recombinant protein of human CD33 molecule (CD33), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP317716 | Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720665 | Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 |
CNY 3140.00 |
|
| TP723960 | Human CD33 Protein, hFc-His Tag |
CNY 5249.00 |
Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 100 µg
