CYP27C1 (NM_001001665) Human Recombinant Protein
CAT#: TP306930
Recombinant protein of human cytochrome P450, family 27, subfamily C, polypeptide 1 (CYP27C1), 20 µg
View other "CYP27C1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206930 representing NM_001001665
Red=Cloning site Green=Tags(s) MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRL GCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRD IQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYILARHPEVQQTVYREI VKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQD ENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAV HAKTHGLLTPGGPIHVRFVNRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001001665 |
| Locus ID | 339761 |
| UniProt ID | Q4G0S4 |
| Refseq Size | 4725 |
| Cytogenetics | 2q14.3 |
| Refseq ORF | 1116 |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, P450 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424236 | CYP27C1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424236 | Transient overexpression lysate of cytochrome P450, family 27, subfamily C, polypeptide 1 (CYP27C1) |
CNY 3080.00 |
|
| PH306930 | CYP27C1 MS Standard C13 and N15-labeled recombinant protein (NP_001001665) |
CNY 19520.00 |
其它CYP27C1产品
