CYP27C1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CYP27C1 Antibody: synthetic peptide directed towards the middle region of human CYP27C1. Synthetic peptide located within the following region: VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	cytochrome P450 family 27 subfamily C member 1
Database Link	NP_001001665 Entrez Gene 339761 Human UniProt ID Q4G0S4
Background	The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.
Synonyms	FLJ16008
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Bovine: 93%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome, P450

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.