MSL3L1 (MSL3) (NM_078629) Human Recombinant Protein
CAT#: TP306888
Recombinant protein of human male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1, 20 µg
View other "MSL3L1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206888 protein sequence
Red=Cloning site Green=Tags(s) MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF LAEYHDDFFPESAYVAACEAHYSTKNPRAIY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_523353 |
| Locus ID | 10943 |
| UniProt ID | Q8N5Y2 |
| Refseq Size | 2359 |
| Cytogenetics | Xp22.2 |
| Refseq ORF | 1563 |
| Synonyms | MRSXBA; MRXS36; MRXSBA; MSL3L1 |
| Summary | This gene encodes a nuclear protein that is similar to the product of the Drosophila male-specific lethal-3 gene. The Drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus, the human protein is thought to play a similar function in chromatin remodeling and transcriptional regulation, and it has been found as part of a complex that is responsible for histone H4 lysine-16 acetylation. This gene can undergo X inactivation. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 7 and 8. [provided by RefSeq, Jul 2010] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409197 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC409198 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409197 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 4 |
CNY 4840.00 |
|
| LY409198 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1 |
CNY 3080.00 |
|
| PH306888 | MSL3 MS Standard C13 and N15-labeled recombinant protein (NP_523353) |
CNY 19520.00 |
