MSL3L1 (MSL3) (NM_078629) Human Mass Spec Standard
CAT#: PH306888
MSL3 MS Standard C13 and N15-labeled recombinant protein (NP_523353)
View other "MSL3L1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MSL3 MS Standard C13 and N15-labeled recombinant protein (NP_523353) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206888 |
| Predicted MW | 59.8 kDa |
| Protein Sequence |
>RC206888 protein sequence
Red=Cloning site Green=Tags(s) MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVDVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAED HVLRDTDENRRLQRKLARKAVARLRSTGRKKKRCRLPGVDSVLKGLPTEEKDENDENSLSSSSDCSENKD EEISEESDIEEKTEVKEEPELQTRREMEERTITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITIL ESYVKHFAINAAFSANERPRHHHVMPHANMNVHYIPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQA QYKKVTSSKFFLPIKESATSTNRSQEELSPSPPLLNPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRR STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAVFAGFEGR RTNEINEVLSWKLVPDNYPPGDQPPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRF LAEYHDDFFPESAYVAACEAHYSTKNPRAIY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_523353 |
| RefSeq Size | 2359 |
| RefSeq ORF | 1563 |
| Synonyms | MRSXBA; MRXS36; MRXSBA; MSL3L1 |
| Locus ID | 10943 |
| Cytogenetics | Xp22.2 |
| Summary | This gene encodes a nuclear protein that is similar to the product of the Drosophila male-specific lethal-3 gene. The Drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus, the human protein is thought to play a similar function in chromatin remodeling and transcriptional regulation, and it has been found as part of a complex that is responsible for histone H4 lysine-16 acetylation. This gene can undergo X inactivation. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 7 and 8. [provided by RefSeq, Jul 2010] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409197 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC409198 | MSL3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409197 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 4 |
CNY 4840.00 |
|
| LY409198 | Transient overexpression lysate of male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1 |
CNY 3080.00 |
|
| TP306888 | Recombinant protein of human male-specific lethal 3 homolog (Drosophila) (MSL3), transcript variant 1, 20 µg |
CNY 2900.00 |
