NPTX2 (NM_002523) Human Recombinant Protein
CAT#: TP306713
Recombinant protein of human neuronal pentraxin II (NPTX2), 20 µg
View other "NPTX2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206713 representing NM_002523
Red=Cloning site Green=Tags(s) MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP VETCEERLLDL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002514 |
Locus ID | 4885 |
UniProt ID | P47972 |
Refseq Size | 2746 |
Cytogenetics | 7q22.1 |
Refseq ORF | 1293 |
Synonyms | NARP; NP-II; NP2 |
Summary | This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD. [provided by RefSeq, Feb 2009] |
Protein Families | Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Neuronal Pentraxin 2 is a regulator of clear cell renal cell carcinoma malignancy through activation of the AMPA-selective glutamate receptor 4
,Von Roemeling, CA;Radisky, DC;Marlow, LA;Cooper, SJ;Grebe, SK;Anastasiadis, PZ;Tun, HW;Copland, JA;,
Cancer Res.
,PubMed ID 24962026
[NPTX2]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419275 | NPTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419275 | Transient overexpression lysate of neuronal pentraxin II (NPTX2) |
CNY 3080.00 |
|
PH306713 | NPTX2 MS Standard C13 and N15-labeled recombinant protein (NP_002514) |
CNY 19520.00 |
|
TP701051 | Purified recombinant protein of Human neuronal pentraxin II (NPTX2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
|
TP710206 | Purified recombinant protein of Human neuronal pentraxin II (NPTX2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |