NPTX2 (NM_002523) Human Mass Spec Standard
CAT#: PH306713
NPTX2 MS Standard C13 and N15-labeled recombinant protein (NP_002514)
View other "NPTX2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NPTX2 MS Standard C13 and N15-labeled recombinant protein (NP_002514) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206713 |
| Predicted MW | 46.9 kDa |
| Protein Sequence |
>RC206713 representing NM_002523
Red=Cloning site Green=Tags(s) MLALLAASVALAVAAGAQDSPAPGSRFVCTALPPEAVHAGCPLPAMPMQGGAQSPEEELRAAVLQLRETV VQQKETLGAQREAIRELTGKLARCEGLAGGKARGAGATGKDTMGDLPRDPGHVVEQLSRSLQTLKDRLES LEHQLRANVSNAGLPGDFREVLQQRLGELERQLLRKVAELEDEKSLLHNETSAHRQKTESTLNALLQRVT ELERGNSAFKSPDAFKVSLPLRTNYLYGKIKKTLPELYAFTICLWLRSSASPGIGTPFSYAVPGQANEIV LIEWGNNPIELLINDKVAQLPLFVSDGKWHHICVTWTTRDGMWEAFQDGEKLGTGENLAPWHPIKPGGVL ILGQEQDTVGGRFDATQAFVGELSQFNIWDRVLRAQEIVNIANCSTNMPGNIIPWVDNNVDVFGGASKWP VETCEERLLDL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002514 |
| RefSeq Size | 2746 |
| RefSeq ORF | 1293 |
| Synonyms | NARP; NP-II; NP2 |
| Locus ID | 4885 |
| Cytogenetics | 7q22.1 |
| Summary | This gene encodes a member of the family of neuronal petraxins, synaptic proteins that are related to C-reactive protein. This protein is involved in excitatory synapse formation. It also plays a role in clustering of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA)-type glutamate receptors at established synapses, resulting in non-apoptotic cell death of dopaminergic nerve cells. Up-regulation of this gene in Parkinson disease (PD) tissues suggests that the protein may be involved in the pathology of PD. [provided by RefSeq, Feb 2009] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419275 | NPTX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419275 | Transient overexpression lysate of neuronal pentraxin II (NPTX2) |
CNY 3080.00 |
|
| TP306713 | Recombinant protein of human neuronal pentraxin II (NPTX2), 20 µg |
CNY 2900.00 |
|
| TP701051 | Purified recombinant protein of Human neuronal pentraxin II (NPTX2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug |
CNY 7106.00 |
|
| TP710206 | Purified recombinant protein of Human neuronal pentraxin II (NPTX2), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
