RAI2 (NM_021785) Human Recombinant Protein
CAT#: TP306638
Recombinant protein of human retinoic acid induced 2 (RAI2), 20 µg
View other "RAI2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206638 protein sequence
Red=Cloning site Green=Tags(s) MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMA LKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVL PQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYA PVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSSSFPKPPSSFGLHPFKGTQ TPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAPLDLSVAAH RKSEPPPETLYDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGN AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 57 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068557 |
| Locus ID | 10742 |
| UniProt ID | Q9Y5P3 |
| Refseq Size | 2229 |
| Cytogenetics | Xp22.13 |
| Refseq ORF | 1590 |
| Summary | Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked cognitive disability, oral-facial-digital syndrome, and Fried syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411926 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433148 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433236 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411926 | Transient overexpression lysate of retinoic acid induced 2 (RAI2) |
CNY 3080.00 |
|
| LY433148 | Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 4 |
CNY 3080.00 |
|
| LY433236 | Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 1 |
CNY 3080.00 |
|
| PH306638 | RAI2 MS Standard C13 and N15-labeled recombinant protein (NP_068557) |
CNY 19520.00 |
