RAI2 (NM_021785) Human Mass Spec Standard
CAT＃: PH306638
RAI2 MS Standard C13 and N15-labeled recombinant protein (NP_068557)
View other "RAI2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RAI2 MS Standard C13 and N15-labeled recombinant protein (NP_068557) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206638 |
| Predicted MW | 57.2 kDa |
| Protein Sequence |
>RC206638 protein sequence
Red=Cloning site Green=Tags(s) MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMA LKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVL PQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYA PVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPVPQSSESKFSSSFPKPPSSFGLHPFKGTQ TPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAPLDLSVAAH RKSEPPPETLYDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGN AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_068557 |
| RefSeq Size | 2229 |
| RefSeq ORF | 1590 |
| Locus ID | 10742 |
| Cytogenetics | Xp22.13 |
| Summary | Retinoic acid plays a critical role in development, cellular growth, and differentiation. The specific function of this retinoic acid-induced gene has not yet been determined but it may play a role in development. The chromosomal location of this gene designates it to be a candidate for diseases such as Nance-Horan syndrome, sensorineural deafness, non-specific X-linked cognitive disability, oral-facial-digital syndrome, and Fried syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411926 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433148 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433236 | RAI2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411926 | Transient overexpression lysate of retinoic acid induced 2 (RAI2) |
CNY 3080.00 |
|
| LY433148 | Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 4 |
CNY 3080.00 |
|
| LY433236 | Transient overexpression lysate of retinoic acid induced 2 (RAI2), transcript variant 1 |
CNY 3080.00 |
|
| TP306638 | Recombinant protein of human retinoic acid induced 2 (RAI2), 20 µg |
CNY 2900.00 |
