Interleukin 34 (IL34) (NM_152456) Human Recombinant Protein
CAT#: TP306629
Recombinant protein of human interleukin 34 (IL34), 20 µg
View other "Interleukin 34" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206629 protein sequence
Red=Cloning site Green=Tags(s) MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 27.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689669 |
| Locus ID | 146433 |
| UniProt ID | Q6ZMJ4 |
| Refseq Size | 1796 |
| Cytogenetics | 16q22.1 |
| Refseq ORF | 726 |
| Synonyms | C16orf77; IL-34 |
| Summary | Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403469 | IL34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432749 | IL34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403469 | Transient overexpression lysate of interleukin 34 (IL34) |
CNY 3080.00 |
|
| LY432749 | Transient overexpression lysate of interleukin 34 (IL34), transcript variant 2 |
CNY 3080.00 |
|
| PH306629 | IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669) |
CNY 19520.00 |
|
| TP723763 | Purified recombinant protein of Human interleukin 34 (IL34), transcript variant 1 |
CNY 5240.00 |
其它Interleukin 34产品
