Interleukin 34 (IL34) (NM_152456) Human Mass Spec Standard
CAT#: PH306629
IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669)
View other "Interleukin 34" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | IL34 MS Standard C13 and N15-labeled recombinant protein (NP_689669) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206629 |
Predicted MW | 27.5 kDa |
Protein Sequence |
>RC206629 protein sequence
Red=Cloning site Green=Tags(s) MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEG VFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVQTLLLNVQQGLTDVEVSP KVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAAT QLYPPPPWSPSSPPHSTGSVRPVRAQGEGLLP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_689669 |
RefSeq Size | 1796 |
RefSeq ORF | 726 |
Synonyms | C16orf77; IL-34 |
Locus ID | 146433 |
Cytogenetics | 16q22.1 |
Summary | Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403469 | IL34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432749 | IL34 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403469 | Transient overexpression lysate of interleukin 34 (IL34) |
CNY 3080.00 |
|
LY432749 | Transient overexpression lysate of interleukin 34 (IL34), transcript variant 2 |
CNY 3080.00 |
|
TP306629 | Recombinant protein of human interleukin 34 (IL34), 20 µg |
CNY 2900.00 |
|
TP723763 | Purified recombinant protein of Human interleukin 34 (IL34), transcript variant 1 |
CNY 5240.00 |
其它Interleukin 34产品