MDC (CCL22) (NM_002990) Human Recombinant Protein
CAT#: TP306578
Recombinant protein of human chemokine (C-C motif) ligand 22 (CCL22), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206578 protein sequence
Red=Cloning site Green=Tags(s) MARLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002981 |
Locus ID | 6367 |
UniProt ID | O00626 |
Refseq Size | 2933 |
Cytogenetics | 16q21 |
Refseq ORF | 279 |
Synonyms | A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1 |
Summary | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418968 | CCL22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418968 | Transient overexpression lysate of chemokine (C-C motif) ligand 22 (CCL22) |
CNY 3080.00 |
|
PH306578 | CCL22 MS Standard C13 and N15-labeled recombinant protein (NP_002981) |
CNY 19520.00 |
|
TP723815 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22 / MDC) |
CNY 4090.00 |