MDC (CCL22) (NM_002990) Human Mass Spec Standard
CAT#: PH306578
CCL22 MS Standard C13 and N15-labeled recombinant protein (NP_002981)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CCL22 MS Standard C13 and N15-labeled recombinant protein (NP_002981) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206578 |
| Predicted MW | 10.6 kDa |
| Protein Sequence |
>RC206578 protein sequence
Red=Cloning site Green=Tags(s) MARLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTF RDKEICADPRVPWVKMILNKLSQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002981 |
| RefSeq Size | 2933 |
| RefSeq ORF | 279 |
| Synonyms | A-152E5.1; ABCD-1; DC/B-CK; MDC; SCYA22; STCP-1 |
| Locus ID | 6367 |
| Cytogenetics | 16q21 |
| Summary | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, dendritic cells, natural killer cells and for chronically activated T lymphocytes. It also displays a mild activity for primary activated T lymphocytes and has no chemoattractant activity for neutrophils, eosinophils and resting T lymphocytes. The product of this gene binds to chemokine receptor CCR4. This chemokine may play a role in the trafficking of activated T lymphocytes to inflammatory sites and other aspects of activated T lymphocyte physiology. [provided by RefSeq, Sep 2014] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418968 | CCL22 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418968 | Transient overexpression lysate of chemokine (C-C motif) ligand 22 (CCL22) |
CNY 3080.00 |
|
| TP306578 | Recombinant protein of human chemokine (C-C motif) ligand 22 (CCL22), 20 µg |
CNY 2900.00 |
|
| TP723815 | Purified recombinant protein of Human chemokine (C-C motif) ligand 22 (CCL22 / MDC) |
CNY 4090.00 |
