Fibromodulin (FMOD) (NM_002023) Human Recombinant Protein
CAT#: TP306534
Recombinant protein of human fibromodulin (FMOD), 20 µg
View other "Fibromodulin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 3 publications. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC206534 protein sequence
Red=Cloning site Green=Tags(s) MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSP PDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQ ITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHN EIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSL TNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRL DGNEIKRSAMPADAPLCLRLASLIEI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Cell treatment (PMID: 25406462) |
| Reference Data | |
| RefSeq | NP_002014 |
| Locus ID | 2331 |
| UniProt ID | Q06828 |
| Refseq Size | 3271 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 1128 |
| Synonyms | FM; SLRR2E |
| Summary | Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
| Protein Families | Druggable Genome, Secreted Protein |
Citations (3)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Differentiated glioma cell-derived fibromodulin activates integrin-dependent Notch signaling in endothelial cells to promote tumor angiogenesis and growth
,null,
eLife
,PubMed ID 35642785
[FMOD]
|
|
Melanocyte pigmentation inversely correlates with MCP-1 production and angiogenesis-inducing potential
,Adini, I;Adini, A;Bazinet, L;Watnick, RS;Bielenberg, DR;D'Amato, RJ;,
FASEB J.
,PubMed ID 25406462
[FMOD]
|
|
Melanocyte-secreted fibromodulin promotes an angiogenic microenvironment
,null,
The Journal of Clinical Investigation
,PubMed ID 24355922
[FMOD]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
其它Fibromodulin产品

