REG1 beta (REG1B) (NM_006507) Human Recombinant Protein
CAT#: TP306451
Recombinant protein of human regenerating islet-derived 1 beta (REG1B), 20 µg
View other "REG1 beta" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206451 protein sequence
Red=Cloning site Green=Tags(s) MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYFNEDPETWVDADLYCQNMNSG NLVSVLTQAEGAFVASLIKESSTDDSNVWIGLHDPKKNRRWHWSSGSLVSYKSWDTGSPSSANAGYCASL TSCSGFKKWKDESCEKKFSFVCKFKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006498 |
Locus ID | 5968 |
UniProt ID | P48304 |
Refseq Size | 812 |
Cytogenetics | 2p12 |
Refseq ORF | 498 |
Synonyms | PSPS2; REGH; REGI-BETA; REGL |
Summary | This gene is a type I subclass member of the Reg gene family. The Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV based on the primary structures of the encoded proteins. This gene encodes a protein secreted by the exocrine pancreas that is highly similar to the REG1A protein. The related REG1A protein is associated with islet cell regeneration and diabetogenesis, and may be involved in pancreatic lithogenesis. Reg family members REG1A, REGL, PAP and this gene are tandemly clustered on chromosome 2p12 and may have arisen from the same ancestral gene by gene duplication. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416596 | REG1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416596 | Transient overexpression lysate of regenerating islet-derived 1 beta (REG1B) |
CNY 3080.00 |
|
PH306451 | REG1B MS Standard C13 and N15-labeled recombinant protein (NP_006498) |
CNY 19520.00 |
其它REG1 beta产品