IL36RN (NM_173170) Human Recombinant Protein
CAT#: TP305747
Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 20 µg
View other "IL36RN" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205747 protein sequence
Red=Cloning site Green=Tags(s) MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_775262 |
Locus ID | 26525 |
UniProt ID | Q9UBH0 |
Refseq Size | 2689 |
Cytogenetics | 2q14.1 |
Refseq ORF | 465 |
Synonyms | FIL1; FIL1(DELTA); FIL1D; IL-36Ra; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; PSORP; PSORS14 |
Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402185 | IL36RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC406658 | IL36RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402185 | Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 |
CNY 3080.00 |
|
LY406658 | Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2 |
CNY 3080.00 |
|
PH305747 | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262) |
CNY 19520.00 |
|
PH311691 | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407) |
CNY 19520.00 |
|
TP311691 | Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 20 µg |
CNY 2900.00 |