IL36RN (NM_012275) Human Mass Spec Standard
CAT#: PH311691
IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407)
View other "IL36RN" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC211691 |
| Predicted MW | 16.8 kDa |
| Protein Sequence |
>RC211691 representing NM_012275
Red=Cloning site Green=Tags(s) MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG GWNAPITDFYFQQCD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036407 |
| RefSeq Size | 2717 |
| RefSeq ORF | 465 |
| Synonyms | FIL1; FIL1(DELTA); FIL1D; IL-36Ra; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; PSORP; PSORS14 |
| Locus ID | 26525 |
| Cytogenetics | 2q14.1 |
| Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402185 | IL36RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406658 | IL36RN HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402185 | Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 |
CNY 3080.00 |
|
| LY406658 | Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2 |
CNY 3080.00 |
|
| PH305747 | IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262) |
CNY 19520.00 |
|
| TP305747 | Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP311691 | Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 20 µg |
CNY 2900.00 |
