LMAN2 (NM_006816) Human Recombinant Protein
CAT#: TP305704
Recombinant protein of human lectin, mannose-binding 2 (LMAN2), 20 µg
View other "LMAN2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205704 protein sequence
Red=Cloning site Green=Tags(s) MAAEGWIWRWGWGRRCLGRPGLLGPGPGPTTPLFLLLLLGSVTADITDGNSEHLKREHSLIKPYQGVGSS SMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRD RLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRD HDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEH TPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVFLLLLCALLGIVVCAVVGAVVFQKRQE RNKRFY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006807 |
| Locus ID | 10960 |
| UniProt ID | Q12907 |
| Refseq Size | 1853 |
| Cytogenetics | 5q35.3 |
| Refseq ORF | 1068 |
| Synonyms | C5orf8; GP36B; VIP36 |
| Summary | This gene encodes a type I transmembrane lectin that shuttles between the endoplasmic reticulum, the Golgi apparatus and the plasma membrane. The encoded protein binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. [provided by RefSeq, Oct 2008] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416403 | LMAN2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416403 | Transient overexpression lysate of lectin, mannose-binding 2 (LMAN2) |
CNY 3080.00 |
|
| PH305704 | LMAN2 MS Standard C13 and N15-labeled recombinant protein (NP_006807) |
CNY 19520.00 |
|
| TP720717 | Purified recombinant protein of Human lectin, mannose-binding 2 (LMAN2) |
CNY 1800.00 |
