LMAN2 Rabbit Polyclonal Antibody
CAT#: TA341862
Rabbit Polyclonal Anti-LMAN2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LMAN2 antibody: synthetic peptide directed towards the N terminal of human LMAN2. Synthetic peptide located within the following region: SLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCF |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 36 kDa |
Gene Name | lectin, mannose binding 2 |
Database Link | |
Background | This gene encodes a type I transmembrane lectin that shuttles betweenThe endoplasmic reticulum,The Golgi apparatus andThe plasma membrane.The encoded protein binds high mannose type glycoproteins and may facilitateTheir sorting, trafficking and quality control. [provided by RefSeq, Oct 2008] |
Synonyms | C5orf8; GP36B; VIP36 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |