EIF4A2 (NM_001967) Human Recombinant Protein
CAT#: TP305623
Recombinant protein of human eukaryotic translation initiation factor 4A, isoform 2 (EIF4A2), 20 µg
View other "EIF4A2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205623 protein sequence
Red=Cloning site Green=Tags(s) MSGGSADYNREHGGPEGMDPDGVIESSWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKG YDVIAQAQSGTGKTATFAISILQQLEIEFKETQALVLAPTRELAQQIQKVILALGDYMGATCHACIGGTN VRNEMQKLQAEAPHIVVGTPGRVFDMLNRRYLSPKWIKMFVLDEADEMLSRGFKDQIYEIFQKLNTSIQV VLLSATMPTDVLEVTKKFMRDPIRILVKKEELTLEGIKQFYINVEREEWKLDTLCDLYETLTITQAVIFL NTRRKVDWLTEKMHARDFTVSALHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDL PTNRENYIHRIGRGGRFGRKGVAINFVTEEDKRILRDIETFYNTTVEEMPMNVADLI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001958 |
| Locus ID | 1974 |
| UniProt ID | Q14240 |
| Refseq Size | 1905 |
| Cytogenetics | 3q27.3 |
| Refseq ORF | 1221 |
| Synonyms | BM-010; DDX2B; eIF-4A-II; EIF4A; eIF4A-II; EIF4F |
| Summary | ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400722 | EIF4A2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400722 | Transient overexpression lysate of eukaryotic translation initiation factor 4A2 (EIF4A2) |
CNY 3080.00 |
|
| PH305623 | EIF4A2 MS Standard C13 and N15-labeled recombinant protein (NP_001958) |
CNY 19520.00 |
