EIF4A2 Rabbit Polyclonal Antibody
CAT#: TA345787
Rabbit Polyclonal Anti-EIF4A2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-EIF4A2 antibody: synthetic peptide directed towards the N terminal of human EIF4A2. Synthetic peptide located within the following region: MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 45 kDa |
| Gene Name | eukaryotic translation initiation factor 4A2 |
| Database Link | |
| Background | EIF4A2 contains 1 helicase C-terminal domain and 1 helicase ATP-binding domain. It belongs to the DEAD box helicase family. eIF4A subfamily. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5' untranslated region of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon. |
| Synonyms | BM-010; DDX2B; eIF-4A-II; EIF4A; eIF4A-II; EIF4F |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
