COMMD1 (NM_152516) Human Recombinant Protein
CAT#: TP305614
Recombinant protein of human copper metabolism (Murr1) domain containing 1 (COMMD1), 20 µg
View other "COMMD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC205614 protein sequence
Red=Cloning site Green=Tags(s) MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_689729 |
| Locus ID | 150684 |
| UniProt ID | Q8N668 |
| Refseq Size | 725 |
| Cytogenetics | 2p15 |
| Refseq ORF | 570 |
| Synonyms | C2orf5; MURR1 |
| Summary | COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]).[supplied by OMIM, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403473 | COMMD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403473 | Transient overexpression lysate of copper metabolism (Murr1) domain containing 1 (COMMD1) |
CNY 3080.00 |
|
| PH305614 | COMMD1 MS Standard C13 and N15-labeled recombinant protein (NP_689729) |
CNY 19520.00 |


