COMMD1 (NM_152516) Human Mass Spec Standard
CAT#: PH305614
COMMD1 MS Standard C13 and N15-labeled recombinant protein (NP_689729)
View other "COMMD1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | COMMD1 MS Standard C13 and N15-labeled recombinant protein (NP_689729) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205614 |
| Predicted MW | 21.2 kDa |
| Protein Sequence |
>RC205614 protein sequence
Red=Cloning site Green=Tags(s) MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689729 |
| RefSeq Size | 725 |
| RefSeq ORF | 570 |
| Synonyms | C2orf5; MURR1 |
| Locus ID | 150684 |
| Cytogenetics | 2p15 |
| Summary | COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]).[supplied by OMIM, Sep 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403473 | COMMD1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403473 | Transient overexpression lysate of copper metabolism (Murr1) domain containing 1 (COMMD1) |
CNY 3080.00 |
|
| TP305614 | Recombinant protein of human copper metabolism (Murr1) domain containing 1 (COMMD1), 20 µg |
CNY 2900.00 |
